Recombinant Human MASH1/Achaete-scute homolog 1 protein (ab152200)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSA QQQQQQQQQQQQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCK RRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAA NKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSND LNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
    • Molecular weight
      52 kDa including tags
    • Amino acids
      1 to 236

Specifications

Our Abpromise guarantee covers the use of ab152200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Achaete scute complex homolog 1
    • Achaete scute complex homolog like 1
    • Achaete scute complex homologue 1
    • Achaete scute complex homologue like 1
    • Achaete scute complex like 1
    • Achaete scute family bHLH transcription factor 1
    • Achaete scute protein
    • Achaete-scute homolog 1
    • Ascl 1
    • ascl1
    • ASCL1_HUMAN
    • Ash 1
    • ASH-1
    • Ash1
    • bHLHa46
    • Class A basic helix-loop-helix protein 46
    • Hash 1
    • HASH1
    • Mammalian achaete scute homolog 1
    • Mammalian achaete scute homologue 1
    • Mash 1
    • Mash1
    see all
  • Function
    May play a role at early stages of development of specific neural lineages in most regions of the CNS, and of several lineages in the PNS. Essential for the generation of olfactory and autonomic neurons. Activates transcription by binding to the E box (5'-CANNTG-3').
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152200 stained with Coomassie Blue.

References

ab152200 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152200.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up