Overview

  • Product name
    Recombinant Human MASP2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLT APPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERA PGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAP TCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPE YPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQT DREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPC PYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQK DGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETF YTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQK AKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMG TLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITP ICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTA AYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVG GIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF
    • Amino acids
      1 to 686
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161136 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Mannan binding lectin serine peptidase 2
    • Mannan binding lectin serine protease 2
    • Mannose binding protein associated serine protease 2
    • MAP 19
    • MAP19
    • MASP 2
    • MBL associated plasma protein of 19 kD
    • MBL associated serine protease 2
    • Small MBL associated protein
    • sMAP
    see all
  • Relevance
    MASP2, MBL associated serine protease 2, is a serum protease that plays an important role in the activation of the complement system via mannose-binding lectin (MBL). Binding of MBL to carbohydrate groups triggers MASP2 activation by auto-catalytic cleavage which leads to cleavage of C2 and C4, leading to their activation and to the formation of C3 convertase. MASP2 also binds to L-Ficolin and H-Ficolin, and when the complex binds pathogens the MASP is activated. Low MBL levels in serum are associated with increased susceptibility to infection, and an Asp105Gly mutation in MASP2 is associated with low MASP2 levels in serum. Reduced functional levels of MBL are also postulated to be associated with generation of autoantibodies in systemic lupus erythematosus, acting through a decreased clearance of apoptotic material. A truncated form of MASP2 that constitutes the amino 185 residues, Map19 is also a component of the MBL-MASP-1 complex.
  • Cellular localization
    Secreted

Images

  • ab161136 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161136 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161136.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up