Overview

  • Product name
    Recombinant Human MAST3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RGQSADKLGTGERLDGEAGRRTRGPEAELVVMRRLHLSERRDSFKKQEAV QEVSFDEPQEEATGLPTSVPQIAVEGEEAVPVALGPTGRD
    • Amino acids
      1229 to 1318
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161509 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 2.7.11.1
    • KIAA0561
    • MAST 3
    • MAST3
    • MAST3_HUMAN
    • Microtubule associated serine/threonine protein kinase 3
    • Microtubule-associated serine/threonine-protein kinase 3
    see all
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 PDZ (DHR) domain.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab161509 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161509 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161509.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up