Recombinant Human MATH1/HATH1 protein (denatured) (ab124546)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ92858
    • SpeciesHuman
    • SequenceMKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQI YINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGA QQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMM AQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
    • Molecular weight21 kDa
    • Amino acids158 to 354

Associated products

Specifications

Our Abpromise guarantee covers the use of ab124546 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 85 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • ATH1
    • ATOH1
    • ATOH1_HUMAN
    • Atonal homolog 1
    • Atonal homolog 1 (Drosophila)
    • bHLHa14
    • Class A basic helix-loop-helix protein 14
    • hATH1
    • Helix loop helix protein hATH 1
    • Helix-loop-helix protein hATH-1
    • MATH 1
    • MATH1
    • Protein atonal homolog 1
    see all
  • FunctionActivates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. May play a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.
  • Sequence similaritiesContains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human MATH1/HATH1 protein (denatured) images

  • 15% SDS-PAGE analysis of 3 µg ab124546.

References for Recombinant Human MATH1/HATH1 protein (denatured) (ab124546)

ab124546 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124546.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"