Recombinant Human MAX binding protein (ab158911)

Overview

  • Product name
    Recombinant Human MAX binding protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SAPSPAVQLAPATPPIGHITVHPATLNHVAHLGSQLPLYPQPVAVSHIAH TLSHQQVNGTAGLGPPATVMAKPAVGAQVVHHPQLVGQTVLNPVTMVTMP SFPVSTLKLA
    • Amino acids
      473 to 582
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158911 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bHLHd3
    • Class D basic helix-loop-helix protein 3
    • MAD6
    • Max binding protein MNT
    • MAX network transcriptional repressor
    • Max-binding protein MNT
    • Mnt
    • MNT_HUMAN
    • MXD6
    • Myc antagonist MNT
    • Protein ROX
    • ROX
    see all
  • Function
    Binds DNA as a heterodimer with MAX and represses transcription. Binds to the canonical E box sequence 5'-CACGTG-3' and, with higher affinity, to 5'-CACGCG-3'.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab158911 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158911 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158911.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up