Recombinant Human Maxi Potassium channel beta protein (ab152489)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWA VLYHTEDTRDQNQQVLNWRDGDTSLYPCQVCEPVPNCPCPRG
    • Molecular weight
      36 kDa including tags
    • Amino acids
      39 to 130

Specifications

Our Abpromise guarantee covers the use of ab152489 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BK channel beta subunit
    • BK channel subunit beta 1
    • BKbeta
    • BKbeta1
    • Calcium activated potassium channel subfamily M subunit beta 1
    • Calcium activated potassium channel subunit beta
    • Calcium activated potassium channel subunit beta 1
    • Charybdotoxin receptor subunit beta 1
    • Hbeta1
    • hslo beta
    • K(VCA)beta
    • K(VCA)beta 1
    • KCNMB 1
    • KCNMB1
    • Large conductance Ca2+ activated K+ channel beta 1 subunit
    • Maxi K channel beta subunit
    • Maxi K channel subunit beta 1
    • Potassium large conductance calcium activated channel subfamily M beta member 1
    • SLO beta
    • Slo beta 1
    see all
  • Relevance
    MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits.
  • Cellular localization
    Membrane; multi-pass membrane protein

Images

  • 12.5% SDS-PAGE analysis of ab152489 stained with Coomassie Blue.

References

ab152489 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152489.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up