Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELT RYLGPACDLTLFDFKQGILCYPAPKAHPVAVASKKRKKPSRPAKTRKRQV GPQSGEVRKEAPRDETKADTDTAPASFPAPGCCENCGISFSGDGTQRQRL KTLCKDCRAQRIAFNREQRMFKRVGCGECAACQVTEDCGACSTCLLQLPH DVASGLFCKCERRRCLRIVERSRGCGVCRGCQTQEDCGHCPICLRPPRPG LRRQWKCVQRRCLRGKHARRKGGCDSKMAARRRPGAQPLPPPPPSQSPEP TEPHPRALAPSPPAEFIYYCVDEDELQPYTNRRQNRKCGACAACLRRMDC GRCDFCCDKPKFGGSNQKRQKCRWRQCLQFAMKRLLPSVWSESEDGAGSP PPYRRRKRPSSARRHHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLP PPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQ EKADTQDEWTPGTAVLTSPVLVPGCPSKAVDPGLPSVKQEPPDPEEDKEE NKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSKDLKKP GARKQ
    • Molecular weight
      93 kDa including tags
    • Amino acids
      1 to 605

Specifications

Our Abpromise guarantee covers the use of ab152512 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CXXC 3
    • CXXC-type zinc finger protein 3
    • CXXC3
    • MBD 1
    • Mbd1
    • MBD1_HUMAN
    • MECP1 COMPLEX
    • Methyl CpG binding domain protein 1
    • Methyl CpG binding domain protein 1 isoform PCM1
    • Methyl CpG binding protein MBD1
    • Methyl CpG binding protein splice variant 1
    • Methyl CpG binding protein splice variant 2
    • Methyl CpG binding protein splice variant 3
    • Methyl CpG binding protein splice variant 4
    • Methyl-CpG-binding domain protein 1
    • Methyl-CpG-binding protein MBD1
    • PCM 1
    • PCM1
    • Protein containing methyl-CpG-binding domain 1
    • Regulator of fibroblast growth factor 2 (FGF 2) transcription
    • RFT
    • The regulator of fibroblast growth factor 2(FGF 2) transcription
    see all
  • Function
    Transcriptional repressor that binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides. Binding is abolished by the presence of 7-mG that is produced by DNA damage by methylmethanesulfonate (MMS). Acts as transcriptional repressor and plays a role in gene silencing by recruiting AFT7IP, which in turn recruits factors such as the histone methyltransferase SETDB1. Probably forms a complex with SETDB1 and ATF7IP that represses transcription and couples DNA methylation and histone 'Lys-9' trimethylation. Isoform 1 and isoform 2 can also repress transcription from unmethylated promoters.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Contains 3 CXXC-type zinc fingers.
    Contains 1 MBD (methyl-CpG-binding) domain.
  • Domain
    The methyl-CpG-binding domain (MBD) functions both in binding to methylated DNA and in protein interactions.
    The third CXXC-type zinc finger mediates binding to non-methylated CpG dinucleotides.
    The transcriptional repression domain (TRD) is involved in transcription repression and in protein interactions.
  • Post-translational
    modifications
    Sumoylated with SUMO1 by PIAS1 and PIAS3. Sumoylation affects transcriptional silencing by preventing the interaction with SETDB1. In contrast, sumoylation may increase interaction with AFT7IP.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus speckle. Chromosome. Nuclear, in a punctate pattern. Associated with euchromatic regions of the chromosomes, with pericentromeric regions on chromosome 1 and with telomeric regions from several chromosomes.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152512 stained with Coomassie Blue.

References

ab152512 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152512.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up