Recombinant Human MBD2 Interacting Zinc Finger MIZF protein (ab161859)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPPPGKVPRKENLWLQCEWGSCSFVCSTMEKFFEHVTQHLQQHLHGSGEE EEEEEEDDPLEEEFSCLWQECGFCSLDSSADLIRHVYFHCYHTKLKQWGL QALQSQADLG
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161859 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp434F162
    • HiNF-P
    • HINFP
    • HINFP_HUMAN
    • Histone H4 gene specific protein HiNF P
    • Histone H4 transcription factor
    • Histone nuclear factor P
    • MBD2 (methyl-CpG-binding protein)-interacting zinc finger protein
    • MBD2 interacting zinc finger 1
    • MBD2 interacting zinc finger protein
    • MBD2-interacting zinc finger protein
    • Methyl CpG binding protein 2 interacting zinc finger protein
    • Methyl-CpG-binding protein 2-interacting zinc finger protein
    • MIZF
    • ZNF743
    see all
  • Function
    Transcriptional repressor that binds to the consensus sequence 5'-CGGACGTT-3' and to the RB1 promoter. Transcriptional activator that promotes histone H4 gene transcription at the G1/S phase transition in conjunction with NPAT. Also activates transcription of the ATM and PRKDC genes. Autoregulates its expression by associating with its own promoter.
  • Tissue specificity
    Ubiquitous. Highly expressed in brain, heart, skeletal muscle, spleen, kidney, small intestine, placenta and liver.
  • Sequence similarities
    Contains 9 C2H2-type zinc fingers.
  • Post-translational
    modifications
    Ubiquitinated. Ubiquitination may lead to proteasome-mediated degradation.
  • Cellular localization
    Nucleus. Associated with discrete nuclear foci.
  • Information by UniProt

Images

  • ab161859 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161859 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161859.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up