Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHENLYFQGGEFGTTGLESLSLGDRGAAPTVTS SERLVPDPPNDLRKEDVAMELERVGEDEEQMMIKRSSECNPLLQEPIASA QFGATAGTECRKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRSKS SLANYLHKNGETSLKPEDFDFTVLSKRGIKSRYKDCSMAALTSHLQNQSN NSNWNLRTRSKCKKDVFMPPSSSSELQESRGLSNFTSTHLLLKEDEGVDD VNFRKVRKPKGKVTILKGIPIKKTKKGCRKSCSGFVQSDSKRESVCNKAD AESEPVAQKSQLDRTVCISDAGACGETLSVTSEENSLVKKKERSLSSGSN FCSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLH TDILKRGSEMDNNCSPTRKDFTGEKIFQEDTIPRTQIERRKTSLYFSSKY NKEALSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGK MAIPVLWKFLEKYPSAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDE YLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWE NHEKLSLS
    • Molecular weight
      69 kDa including tags
    • Amino acids
      2 to 580
    • Additional sequence information
      Constructed with a small T7-His-TEV cleavage site Tag (31 amino acids) fusion at the N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab185595 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab185595 was expressed in E. coli as inclusion bodies, refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names
    • 3 N(4) ethenocytosine glycosylase
    • G/5 fluorouracil mismatch glycosylase with biphasic kinetics
    • G/T mismatch glycosylase
    • G/U mismatch glycosylase
    • MBD 4
    • MBD4
    • MBD4_HUMAN
    • MED 1
    • MED1
    • Methyl CpG binding domain protein 4
    • Methyl CpG binding endonuclease 1
    • Methyl CpG binding protein MBD4
    • Methyl-CpG-binding domain protein 4
    • Methyl-CpG-binding endonuclease 1
    • Methyl-CpG-binding protein MBD4
    • Mismatch specific DNA N glycosylase
    • Mismatch-specific DNA N-glycosylase
    • Putative methyl CpG binding protein
    see all
  • Function
    Mismatch-specific DNA N-glycosylase involved in DNA repair. Has thymine glycosylase activity and is specific for G:T mismatches within methylated and unmethylated CpG sites. Can also remove uracil or 5-fluorouracil in G:U mismatches. Has no lyase activity. Was first identified as methyl-CpG-binding protein.
  • Sequence similarities
    Contains 1 MBD (methyl-CpG-binding) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

References

ab185595 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185595.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up