Overview

  • Product name
    Recombinant Human MBD5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFPPTANMLLPTGEGQSGRAALRDKLMSQQKDALRKRKQPPTTVLSLLRQ SQMDSSAVPKPGPDLLRKQGQGSFPISSMSQLLQSMSCQSSHLSSNSTPG CGASNTALPCSANQLHFTDPSMNSSVLQNIPLRGEAVHCHNANTNFVHSN SPVPNHHLAGLINQIQASGNCGMLSQSGMALGNSLHPNPPQSRISTSSTP VIPNSIVSSYNQTSSEAGMVLLEKSTQRY
    • Amino acids
      1 to 229
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab163214 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 9430004D19Rik
    • AA536666
    • AI426407
    • C030040A15Rik
    • FLJ11113
    • FLJ30517
    • KIAA1461
    • MBD5
    • MBD5_HUMAN
    • methyl CpG binding domain protein 5
    • Methyl CpG binding protein MBD5
    • Methyl-CpG-binding domain protein 5
    • Methyl-CpG-binding protein MBD5
    • RP23 167N13.1
    see all
  • Function
    Binds to heterochromatin. Does not interact with either methylated or unmethylated DNA (in vitro).
  • Tissue specificity
    Detected in heart, placenta, liver, skeletal muscle, kidney and pancreas.
  • Involvement in disease
    Defects in MBD5 are the cause of mental retardation autosomal dominant type 1 (MRD1) [MIM:156200]. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period.
  • Sequence similarities
    Contains 1 MBD (methyl-CpG-binding) domain.
    Contains 1 PWWP domain.
  • Domain
    Both MBD and PWWP domains are necessary for chromocentric localization.
  • Cellular localization
    Nucleus. Chromosome. Associated with pericentric heterochromatin and Nucleus. Not associated with pericentric heterochromatin.
  • Information by UniProt

Images

  • ab163214 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163214 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163214.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up