Recombinant Human MBOAT1 protein (ab165676)

Overview

  • Product name
    Recombinant Human MBOAT1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWF RIYLRPGTTSSDVRHAVATIFGIYFVIFCFGWYSVHLFVLVLMCYAIMVT ASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGPLMIVTQKIT TLAFQVHDGLGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFMSVIAGPC NNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTGAVIHKLGITLV SLLLFLTLTKTFPVTCLVDDWFVHKASFPARLCYLYVVMQASKPKYYFAW TLADAVNNAAGFGFSGVDKNGNFCWDLLSNLNIWKIETATSFKMYLENWN IQTATWLKCVCYQRVHGTPRC
    • Amino acids
      1 to 371
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165676 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1 acylglycerophosphoethanolamine O acyltransferase
    • LPE acyltransferase 1
    • LPEAT1
    • LysoPE acyltransferase
    • lysophosphatidylethanolamine acyltransferase 1
    • lysophospholipid acyltransferase
    • LysoPS acyltransferase
    • membrane bound O acyltransferase domain containing 1
    • O acyltransferase (membrane bound) domain containing 1
    • O acyltransferase domain containing protein 1
    • OACT1
    see all
  • Relevance
    MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases which transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets.
  • Cellular localization
    Membrane; Multi-pass membrane protein

Images

  • ab165676 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165676 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165676.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up