Recombinant Human MBOAT2 protein (ab165316)

Overview

  • Product name
    Recombinant Human MBOAT2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPSLLEYLSYNCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEET QYERTEPSPNTAVVQKLLVCGLSLLFHLTICTTLPVEYNIDEHFQATASW PTKIIYLYISLLAARPKYYFAWTLADAINNAAGFGFRGYDENGAARWDLI SNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERTSFSPTIQTFILSA IWHGVYPGYYLTFLTGVLMTLAARAMRNNFRHYFIEPSQLKLFYDVITWI VTQVAISYTVVPFVLLSIKPSLTFYSSWYYCLHILGILVLLLLPVKKTQR RKNTHENIQLSQSKKFDEGENSLGQNSFSTTNNVCNQNQEIASRHSSLKQ
    • Amino acids
      1 to 350
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165316 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1-acylglycerophosphate O-acyltransferase
    • 1-acylglycerophosphoethanolamine O-acyltransferase
    • LPAAT
    • LPCAT4
    • LPEAT
    • LPLAT 2
    • Lyso-PA acyltransferase
    • Lyso-PE acyltransferase
    • Lysophosphatidic acid acyltransferase
    • Lysophosphatidylethanolamine acyltransferase
    • Lysophospholipid acyltransferase 2
    • MBOA2_HUMAN
    • Mboat2
    • Membrane bound O acyltransferase domain containing 2
    • Membrane-bound O-acyltransferase domain-containing protein 2
    • O acyltransferase (membrane bound) domain containing 2
    • O-acyltransferase domain-containing protein 2
    • OACT2
    see all
  • Function
    Acyltransferase which mediates the conversion of lysophosphatidylethanolamine (1-acyl-sn-glycero-3-phosphoethanolamine or LPE) into phosphatidylethanolamine (1,2-diacyl-sn-glycero-3-phosphoethanolamine or PE) (LPEAT activity). Catalyzes also the acylation of lysophosphatidic acid (LPA) into phosphatidic acid (PA) (LPAAT activity). Has also a very weak lysophosphatidylcholine acyltransferase (LPCAT activity). Prefers oleoyl-CoA as the acyl donor. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle.
  • Tissue specificity
    Expressed in neutrophils.
  • Pathway
    Lipid metabolism; phospholipid metabolism.
  • Sequence similarities
    Belongs to the membrane-bound acyltransferase family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab165316 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165316 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165316.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up