Recombinant Human MC1 Receptor protein (ab114642)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGL VSLVENALVVATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 100

Specifications

Our Abpromise guarantee covers the use of ab114642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CMM5
    • MC1-R
    • MC1R
    • Melanocortin 1 receptor
    • Melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor)
    • Melanocortin receptor 1
    • Melanocyte-stimulating hormone receptor
    • Melanotropin receptor
    • MSH-R
    • MSHR
    • MSHR_HUMAN
    • SHEP2
    see all
  • Function
    Receptor for MSH (alpha, beta and gamma) and ACTH. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
  • Tissue specificity
    Melanocytes and corticoadrenal tissue.
  • Involvement in disease
    Genetic variations in MC1R are a cause of susceptibility to cutaneous malignant melanoma type 5 (CMM5) [MIM:613099]. Malignant melanoma is a malignant neoplasm of melanocytes, arising de novo or from a pre-existing benign nevus, which occurs most often in the skin but also may involve other sites.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human MC1 Receptor protein images

  • 12.5% SDS-PAGE image showing ab114642 Stained with Coomassie Blue.

References for Recombinant Human MC1 Receptor protein (ab114642)

ab114642 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up