Recombinant Human MC4 Receptor protein (ab112318)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQ
    • Molecular weight
      30 kDa including tags
    • Amino acids
      1 to 43
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112318 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MC4-R
    • MC4R
    • MC4R_HUMAN
    • Melanocortin 4 receptor
    • Melanocortin receptor 4
    • MGC126851
    • MGC138197
    see all
  • Function
    Receptor specific to the heptapeptide core common to adrenocorticotropic hormone and alpha-, beta-, and gamma-MSH. This receptor is mediated by G proteins that stimulate adenylate cyclase.
  • Tissue specificity
    Brain, placental, and gut tissues.
  • Involvement in disease
    Defects in MC4R are a cause of obesity (OBESITY) [MIM:601665]. It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human MC4 Receptor protein images

  • ab112318 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human MC4 Receptor protein (ab112318)

ab112318 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112318.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up