Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNSGVAMKYGNDSSAELSELHSAALASLKGDIVELNKRLQQTERERDLLE KKLAKAQCEQSHLMREHEDVQERTTLRYEERITELHSVIAELNKKIDRLQ GTTIREEDEYSELRSELSQSQHEVNEDSRSMDQDQTSVSIPENQSTMVTA DMDNCSDLNSELQRVLTGLENVVCGRKKSSCSLSVAEVDRHIEQLTTASE HCDLAIKTVEEIEGVLGRDLYPNLAEERSRWEKELAGLREENESLTAMLC SKEEELNRTKATMNAIREERDRLRRRVRELQTRLQSVQATGPSSPGRLTS TNRPINPSTGELSTSSSSNDIPIAKIAERVKLSKTRSESSSSDRPVLGSE ISSIGVSSSVAEHLAHSLQDCSNIQEIFQTLYSHGSAISESKIREFEVET ERLNSRIEHLKSQNDLLTITLEECKSNAERMSMLVGKYESNATALRLALQ YSEQCIEAYELLLALAESEQSLILGQFRAAGVGSSPGDQSGDENITQMLK RAHDCRKTAENAAKALLMKLDGSCGGAFAVAGCSVQPWESLSSNSHTSTT SSTASSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSY DVKPRGDSQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKL STREAQEQAYLVHIEHLKSEVEEQKEQRMRSLSSTSSGSKDKPGKECADA ASPALSLAELRTTCSENELAAEFTNAIRREKKLKARVQELVSALERLTKS SEIRHQQSAEFVNDLKRANSNLVAAYEKAKKKHQNKLKKLESQMMAMVER HETQVRMLKQRIALLEEENSRPHTNETSL
    • Amino acids
      1 to 829
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Colorectal mutant cancer protein
    • CRCM_HUMAN
    • DKFZp762O1615
    • FLJ38893
    • FLJ46755
    • MCC
    • MCC 1
    • MCC1
    • Mutated in colorectal cancers
    • Protein MCC
    see all
  • Function
    Candidate for the putative colorectal tumor suppressor gene located at 5q21. Suppresses cell proliferation and the Wnt/b-catenin pathway in colorectal cancer cells. Inhibits DNA binding of b-catenin/TCF/LEF transcription factors. Involved in cell migration independently of RAC1, CDC42 and p21-activated kinase (PAK) activation.
  • Tissue specificity
    Expressed in a variety of tissues.
  • Sequence similarities
    Belongs to the MCC family.
  • Cellular localization
    Cell membrane. Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • ab158865 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158865 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up