Overview

  • Product nameRecombinant Human MCEE protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ96PE7
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMQVTGSVWNLGRLNHVAIAVPDLEKAAAFY KNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKN KAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKD CGGVLVELEQA
    • Molecular weight17 kDa including tags
    • Amino acids37 to 176
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99864 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • DL methylmalonyl CoA racemase
    • DL-methylmalonyl-CoA racemase
    • EC 5.1.99.1
    • GLOD2
    • Glyoxalase domain containing 2
    • MCEE
    • MCEE_HUMAN
    • Methylmalonyl CoA epimerase
    • Methylmalonyl-CoA epimerase
    • methylmalonyl-CoA epimerase, mitochondrial
    • mitochondrial
    • OTTHUMP00000160122
    see all
  • Involvement in diseaseDefects in MCEE are a cause of methylmalonyl-CoA epimerase deficiency (MCEE deficiency) [MIM:251120]; also known as methylmalonyl-CoA racemase deficiency or methylmalonic aciduria type 3. MCEE deficiency is an autosomal recessive inborn error of amino acid metabolism, involving valine, threonine, isoleucine and methionine. This organic aciduria may present in the neonatal period with life-threatening metabolic acidosis, hyperammonemia, feeding difficulties, pancytopenia and coma.
  • Sequence similaritiesBelongs to the glyoxalase I family.
  • Cellular localizationMitochondrion.
  • Information by UniProt

Recombinant Human MCEE protein images

  • 15% SDS-PAGE showing ab99864 (3µg).

References for Recombinant Human MCEE protein (ab99864)

ab99864 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"