Overview

  • Product name
    Recombinant Human MCG10 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TTGAQVQVAGDLLPNSTERAVTVSGVPDAIILCVRQICAVILESPPKGAT IPYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSSHAVPFATP SVVPGLDPGT
    • Amino acids
      130 to 239
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163470 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha CP4
    • LIP4
    • LYST interacting protein
    • PCBP4
    • poly(rC) binding protein 4
    • rCbinding protein 4
    • RNA binding protein MCG10
    see all
  • Relevance
    MCG10 is a member of the KH-domain RNA-binding protein family. Proteins of this family bind to RNA with specificity for C-rich pyrimidine regions. MCG10 is induced by p53 and DNA damage via two p53-responsive promoter elements.

Images

  • ab163470 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163470 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163470.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up