Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQP AWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPP RTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIF IINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQLTST YILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLY ARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRI LQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLS ISRPTLTLVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQ GQLRAVSNAQTADEERTESKGT
    • Amino acids
      1 to 422
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158564 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G protein coupled receptor 24
    • GPCR MCH1
    • GPCR SLC/MCH1
    • GPR24
    • MCH 1R
    • MCH receptor 1
    • MCH-1R
    • MCH-R1
    • MCH1R
    • MCHR
    • MCHR-1
    • Melanin concentrating hormone receptor 1
    • SLC-1
    • SLC1
    • Somatostatin receptor like protein
    see all
  • Relevance
    MCHR, a member of the G protein coupled receptor family 1, is an integral plasma membrane protein which binds melanin concentrating hormone. MCHR can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, MCHR does not seem to bind somatostatin.
  • Cellular localization
    Cell Membrane; multi-pass membrane protein

Images

  • ab158564 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158564 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158564.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up