Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ14566
    • SpeciesHuman
    • SequenceMDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLA EELIRPERNTLVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKD RKEIPLAKDFYVAFQDLPTRHKIRELTSSRIGLLTRISGQVVRTHPVHPE LVSGTFLCLDCQTVIRDVEQQFKYTQPNICRNPVCANRRRFLLDTNKSRF VDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGDKCDFTGTLIV VPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLA CCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNL CTSLFPTIHGNDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPST AKSQFLKHVEEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALM LADNGVCCIDEFDKMDVRDQVAIHEAMEQQTISITKAGVKATLNARTSIL AAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIAR RIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKH LRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFR LLNKSIIRVETPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYN EDINQESAPKASLRLGFSEYCRISNLIVLHLRKVEEEEDESALKRSELVN WYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTE GSESYEEDPYLVVNPNYLLED
    • Molecular weight116 kDa including tags
    • Amino acids1 to 821

Specifications

Our Abpromise guarantee covers the use of ab114758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DNA replication licensing factor MCM6
    • MCG40308
    • Mcm6
    • MCM6 minichromosome maintenance deficient 6
    • MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe)
    • MCM6_HUMAN
    • Minichromosome maintenance complex component 6
    • Minichromosome maintenance deficient (mis5 S. pombe) 6
    • Minichromosome maintenance deficient 6 homolog
    • Minichromosome maintenance protein 6
    • Mis5
    • MIS5 homolog
    • p105MCM
    see all
  • FunctionActs as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.
  • Sequence similaritiesBelongs to the MCM family.
    Contains 1 MCM domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus. Binds to chromatin during G1 and detach from it during S phase.
  • Information by UniProt

Recombinant Human MCM6 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114758 at approximately 116.38kDa.

References for Recombinant Human MCM6 protein (ab114758)

ab114758 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"