Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP33993-2
    • SpeciesHuman
    • SequenceMALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYV DLDDVAEDDPELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLD VYIEHRLMMEQRSRDPGMVRSPQNQYPAELMRRFELYFQGPSSSKPRVIR EVRADSVGKLVTVRGIVTRVSEVKPKMVVATYTCDQCGAETYQPIQSPTF MPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIP RSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEA HRIVKMNKSEDDESGAGELTREELRQIADVIFATVRELVSGGRSVRFSEA EQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV
    • Molecular weight69 kDa including tags
    • Amino acids1 to 389

Specifications

Our Abpromise guarantee covers the use of ab114356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDABP0042
    • CDC 47
    • CDC47
    • CDC47 homolog
    • Cdc47, S. cerevisiae, homolog of
    • DNA replication licensing factor MCM7
    • Homolog of S. cerevisiae Cdc47
    • MCM 2
    • MCM 7
    • MCM2
    • MCM2, formerly
    • Mcm7
    • MCM7 minichromosome maintenance deficient 7
    • MCM7_HUMAN
    • Minichromosome Maintainence 7
    • Minichromosome maintainence, S. cerevisiae, homolog of
    • Minichromosome maintenance complex component 7
    • Minichromosome maintenance deficient 7
    • Minichromosome maintenance protein 7
    • P1.1 MCM3
    • P1.1-MCM3
    • P1CDC47
    • P85MCM
    • PNAS 146
    • PNAS146
    see all
  • FunctionActs as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for S-phase checkpoint activation upon UV-induced damage.
  • Sequence similaritiesBelongs to the MCM family.
    Contains 1 MCM domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human MCM7 protein images

  • ab114356 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human MCM7 protein (ab114356)

ab114356 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"