Overview

  • Product name
    Recombinant Human MCM8 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNNVAERTYNNIFQFHQL RQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQTM
    • Amino acids
      646 to 735
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164604 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C20orf154
    • dJ967N21.5
    • DNA helicase MCM8
    • DNA replication licensing factor MCM8
    • MCM8
    • MCM8_HUMAN
    • MGC119522
    • MGC119523
    • MGC12866
    • MGC4816
    • Minichromosome maintenance 8
    • Minichromosome maintenance complex component 8
    • REC
    see all
  • Function
    Component of the MCM8-MCM9 complex, a complex involved in homologous recombination repair following DNA interstrand cross-links and plays a key role during gametogenesis. The MCM8-MCM9 complex probably acts as a hexameric helicase downstream of the Fanconi anemia proteins BRCA2 and RAD51 and is required to process aberrant forks into homologous recombination substrates and to orchestrate homologous recombination with resection, fork stabilization and fork restart. May also play a non-essential for DNA replication: may be involved in the activation of the prereplicative complex (pre-RC) during G(1) phase by recruiting CDC6 to the origin recognition complex (ORC). Binds chromatin throughout the cell cycle.
  • Tissue specificity
    Highest levels in placenta, lung and pancreas. Low levels in skeletal muscle and kidney. Expressed in various tumors with highest levels in colon and lung cancers.
  • Sequence similarities
    Belongs to the MCM family.
    Contains 1 MCM domain.
  • Cellular localization
    Nucleus. Localizes to nuclear foci and colocalizes with RAD51.
  • Information by UniProt

Images

  • ab164604 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164604 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164604.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up