Overview

  • Product name
    Recombinant Human MCM9 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFET NMEIGEYFNMFPSEVLTIFDSALRRSALTILQSLSQPEAVSMKQNLHARI
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166034 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C6orf61
    • DNA replication licensing factor MCM9
    • hMCM9
    • MCMDC1
    • Mini-chromosome maintenance deficient 9
    • Mini-chromosome maintenance deficient domain-containing protein 1
    see all
  • Relevance
    MCM9, a member of the MCM2-8 family, binds to chromatin and is required for the recruitment of the MCM2-7 helicase onto chromatin. MCM9 can form a complex with Cdt1. It is thought that MCM9 might play an important role in DNA replication since its depletion results in its inhibition.

Images

  • ab166034 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166034 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166034.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up