Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQD FGFSVEKCSKQLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYP ICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKRS TVACANATIMCS
    • Amino acids
      1 to 162
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160494 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BPAD
    • dJ80N2.1
    • Ly 86
    • Ly-86
    • Ly86
    • LY86_HUMAN
    • Lymphocyte antigen 86
    • Lymphocyte antigen 86 precursor
    • Major affective disorder 1
    • MD 1
    • MD1 protein
    • MD1 RP105 associated
    • MMD 1
    • Protein MD 1
    • Protein MD-1
    • RP1-80N2.1
    see all
  • Function
    May cooperate with CD180 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS) and cytokine production. Important for efficient CD180 cell surface expression.
  • Tissue specificity
    Highly expressed in B-cells, monocytes and tonsil.
  • Cellular localization
    Secreted > extracellular space. Associated with CD180 at the cell surface.
  • Information by UniProt

Images

  • ab160494 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160494 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160494.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up