Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP40925
    • SpeciesHuman
    • SequenceMSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVL DGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKD LLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKE NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV KLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAI CDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFV EGLPINDFSREKMDLTAKELTEEKESAFEFLSSALEHHHHHH
    • Molecular weight37 kDa including tags
    • Amino acids1 to 334
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99244 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab99244 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • cytoplasmic
    • Cytosolic malate dehydrogenase
    • Diiodophenylpyruvate reductase
    • Malate dehydrogenase
    • Malate dehydrogenase 1, NAD (soluble)
    • Malate dehydrogenase cytoplasmic
    • MDH s
    • mdh1
    • MDHA
    • MDHC_HUMAN
    • MDHs
    • MGC:1375
    • MOR2
    • Soluble malate dehydrogenase
    see all
  • Sequence similaritiesBelongs to the LDH/MDH superfamily. MDH type 2 family.
  • Post-translational
    modifications
    ISGylated.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human MDH1 protein images

  • 15% SDS-PAGE showing ab99244 (3µg).

References for Recombinant Human MDH1 protein (ab99244)

ab99244 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99244.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"