Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVL DGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKD LLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKE NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV KLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAI CDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFV EGLPINDFSREKMDLTAKELTEEKESAFEFLSSALEHHHHHH
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 334
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99244 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99244 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • cytoplasmic
    • Cytosolic malate dehydrogenase
    • Diiodophenylpyruvate reductase
    • Malate dehydrogenase
    • Malate dehydrogenase 1, NAD (soluble)
    • Malate dehydrogenase cytoplasmic
    • MDH s
    • mdh1
    • MDHA
    • MDHC_HUMAN
    • MDHs
    • MGC:1375
    • MOR2
    • Soluble malate dehydrogenase
    see all
  • Sequence similarities
    Belongs to the LDH/MDH superfamily. MDH type 2 family.
  • Post-translational
    modifications
    ISGylated.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99244 (3µg).

References

ab99244 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99244.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up