Recombinant human MDH2 protein (ab99238)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP40926
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAKVAVLGASGGIGQPLSLLLKNSPLVSRL TLYDIAHTPGVAADLSHIETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVP RKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVIANPVNSTIPITAE VFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGK TIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSMAY AGARFVFSLVDAMNGKEGVVECSFVKSQETECTYFSTPLLLGKKGIEKNL GIGKVSSFEEKMISDAIPELKASIKKGEDFVKTLK
    • Molecular weight35 kDa including tags
    • Amino acids25 to 338
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific activity is > 30 units/mg, and is defined as the amount of enzyme that cleaves 1umole of oxalacetate and beta-NADH to L-malate and beta-NAD per minute at pH7.5 at 25°C

    Activity Assay

    1. Prepare assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 100 mM Potassium phosphate, 0.13mM beta-nicotinamide adenine dinucleotide, reduced form, 0.25mM oxalacetic acid.
    2. Add recombinant MDH protein with various concentrations (0.1ug, 0.5ug, 1ug) in assay buffer.
    3. Mix by inversion and equilibrate to 1°C and monitor at A340nm until the value is constant using a spectrophotometer.
    4. Record the increase at A340nm for approximately 2 minutes
  • Applications

    SDS-PAGE

    Mass Spectrometry

    Functional Studies

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab99238 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 7.5

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • M MDH
    • Malate dehydrogenase
    • Malate dehydrogenase 2, NAD (mitochondrial)
    • Malate dehydrogenase, mitochondrial
    • MDH
    • mdh2
    • MDHM_HUMAN
    • MGC:3559
    • mitochondrial
    • Mitochondrial malate dehydrogenase 2, NAD
    • Mor 1
    • MOR1
    see all
  • Sequence similaritiesBelongs to the LDH/MDH superfamily. MDH type 1 family.
  • Post-translational
    modifications
    Acetylation is enhanced by up to 67% after treatment either with trichostin A (TSA) or with nicotinamide (NAM) with the appearance of tri-and tetraacetylations. Glucose also increases acetylation by about 60%.
  • Cellular localizationMitochondrion matrix.
  • Information by UniProt

Recombinant human MDH2 protein images

  • 15% SDS-PAGE showing ab99238 at approximately 35.2kDa (3µg).

References for Recombinant human MDH2 protein (ab99238)

ab99238 has not yet been referenced specifically in any publications.

Product Wall


Could you tell me whether these proteins are also active in catalysing the reverse of that reaction, as in the generation of NADH and oxaloacetic acid from malate and NAD+?



The MDH2 protein is biologically active which means it...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"