Recombinant human MDH2 protein (ab99238)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAKVAVLGASGGIGQPLSLLLKNSPLVSRL TLYDIAHTPGVAADLSHIETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVP RKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVIANPVNSTIPITAE VFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGK TIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSMAY AGARFVFSLVDAMNGKEGVVECSFVKSQETECTYFSTPLLLGKKGIEKNL GIGKVSSFEEKMISDAIPELKASIKKGEDFVKTLK
    • Molecular weight
      35 kDa including tags
    • Amino acids
      25 to 338
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity is > 30 units/mg, and is defined as the amount of enzyme that cleaves 1umole of oxalacetate and beta-NADH to L-malate and beta-NAD per minute at pH7.5 at 25°C

    Activity Assay

    1. Prepare assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 100 mM Potassium phosphate, 0.13mM beta-nicotinamide adenine dinucleotide, reduced form, 0.25mM oxalacetic acid.
    2. Add recombinant MDH protein with various concentrations (0.1ug, 0.5ug, 1ug) in assay buffer.
    3. Mix by inversion and equilibrate to 1°C and monitor at A340nm until the value is constant using a spectrophotometer.
    4. Record the increase at A340nm for approximately 2 minutes
  • Applications

    SDS-PAGE

    Mass Spectrometry

    Functional Studies

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99238 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 7.5

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • M MDH
    • Malate dehydrogenase
    • Malate dehydrogenase 2, NAD (mitochondrial)
    • Malate dehydrogenase, mitochondrial
    • MDH
    • mdh2
    • MDHM_HUMAN
    • MGC:3559
    • mitochondrial
    • Mitochondrial malate dehydrogenase 2, NAD
    • Mor 1
    • MOR1
    see all
  • Sequence similarities
    Belongs to the LDH/MDH superfamily. MDH type 1 family.
  • Post-translational
    modifications
    Acetylation is enhanced by up to 67% after treatment either with trichostin A (TSA) or with nicotinamide (NAM) with the appearance of tri-and tetraacetylations. Glucose also increases acetylation by about 60%.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99238 at approximately 35.2kDa (3µg).

References

ab99238 has not yet been referenced specifically in any publications.

Customer reviews and Q&As


Could you tell me whether these proteins are also active in catalysing the reverse of that reaction, as in the generation of NADH and oxaloacetic acid from malate and NAD+?



The MDH2 protein is biologically active which means it...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up