Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVK EVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYD MLRKNLVTLATATTDAAQTLALAQDHSMDIPSQDQLKQSAEESSTSRKRT TEDDIPTLPTSEHKCIHSREDEDLIENLAQDETSRLDLGFEEWDVAGLPW WFLGNLRSNYTPRSNGSTDLQTNQDVGTAIVSDTTDDLWFLNESVSEQLG VGIKVEAADTEQTSEEVGKVSDKKVIEVGKNDDLEDSKSLSDDTDVEVTS EDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIP EKENEGNDVPDCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHS SESQETISSMGEQLDNLSEQRTDTENMEDCQNLLKPCSLCEKRPRDGNII HGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA
    • Molecular weight
      80 kDa including tags
    • Amino acids
      1 to 490

Specifications

Our Abpromise guarantee covers the use of ab114467 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114467 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • DKFZp781B1423
    • Double minute 4
    • Double minute 4 human homolog of p53 binding protein
    • Double minute 4 protein
    • HDMX
    • MDM 4
    • Mdm2 like p53 binding protein
    • Mdm2-like p53-binding protein
    • MDM4
    • Mdm4 p53 binding protein homolog mouse
    • Mdm4 protein
    • MDM4 related protein 1
    • Mdm4 transformed 3T3 cell double minute 4
    • Mdm4 transformed 3T3 cell double minute 4 p53 binding protein
    • Mdm4 transformed 3T3 cell double minute 4 p53 binding protein mouse
    • MDM4_HUMAN
    • Mdmx protein
    • MGC132766
    • Mouse double minute 4 homolog
    • Mouse double minute 4 human homolog of p53 binding protein
    • MRP 1
    • MRP1
    • p53 binding protein
    • p53 BINDING PROTEIN MDM4
    • p53-binding protein Mdm4
    • Protein Mdm4
    • Protein Mdmx
    see all
  • Function
    Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Inhibits degradation of MDM2. Can reverse MDM2-targeted degradation of TP53 while maintaining suppression of TP53 transactivation and apoptotic functions.
  • Tissue specificity
    Expressed in all tissues tested with high levels in thymus.
  • Sequence similarities
    Belongs to the MDM2/MDM4 family.
    Contains 1 RanBP2-type zinc finger.
    Contains 1 RING-type zinc finger.
    Contains 1 SWIB domain.
  • Domain
    Region I is sufficient for binding TP53 and inhibiting its G1 arrest and apoptosis functions. It also binds TP73. Region II contains most of a central acidic region and a putative C4-type zinc finger. The RING finger domain which coordinates two molecules of zinc mediates the heterooligomerization with MDM2.
  • Post-translational
    modifications
    Ubiquitinated. Deubiquitinated by USP2; leading to stabilize it.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab114467 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab114467 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114467.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up