Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO15151
    • SpeciesHuman
    • SequenceENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQRTDTENMEDC QNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKE IQLVIKVFIA
    • Molecular weight38 kDa including tags
    • Amino acids381 to 490

Specifications

Our Abpromise guarantee covers the use of ab114468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114468 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • DKFZp781B1423
    • Double minute 4
    • Double minute 4 human homolog of p53 binding protein
    • Double minute 4 protein
    • HDMX
    • MDM 4
    • Mdm2 like p53 binding protein
    • Mdm2-like p53-binding protein
    • MDM4
    • Mdm4 p53 binding protein homolog mouse
    • Mdm4 protein
    • MDM4 related protein 1
    • Mdm4 transformed 3T3 cell double minute 4
    • Mdm4 transformed 3T3 cell double minute 4 p53 binding protein
    • Mdm4 transformed 3T3 cell double minute 4 p53 binding protein mouse
    • MDM4_HUMAN
    • Mdmx protein
    • MGC132766
    • Mouse double minute 4 homolog
    • Mouse double minute 4 human homolog of p53 binding protein
    • MRP 1
    • MRP1
    • p53 binding protein
    • p53 BINDING PROTEIN MDM4
    • p53-binding protein Mdm4
    • Protein Mdm4
    • Protein Mdmx
    see all
  • FunctionInhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Inhibits degradation of MDM2. Can reverse MDM2-targeted degradation of TP53 while maintaining suppression of TP53 transactivation and apoptotic functions.
  • Tissue specificityExpressed in all tissues tested with high levels in thymus.
  • Sequence similaritiesBelongs to the MDM2/MDM4 family.
    Contains 1 RanBP2-type zinc finger.
    Contains 1 RING-type zinc finger.
    Contains 1 SWIB domain.
  • DomainRegion I is sufficient for binding TP53 and inhibiting its G1 arrest and apoptosis functions. It also binds TP73. Region II contains most of a central acidic region and a putative C4-type zinc finger. The RING finger domain which coordinates two molecules of zinc mediates the heterooligomerization with MDM2.
  • Post-translational
    modifications
    Ubiquitinated. Deubiquitinated by USP2; leading to stabilize it.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human MDMX protein images

  • ab114468 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human MDMX protein (ab114468)

ab114468 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114468.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"