Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ86V88
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMARLPKLAVFDLDYTLWPFWVDTHVD PPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEG ANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERR NIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA
    • Molecular weight23 kDa including tags
    • Amino acids1 to 176
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101631 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab101631 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • FN6Pase
    • Fructosamine-6-phosphatase
    • Magnesium dependent phosphatase 1
    • Magnesium-dependent phosphatase 1
    • MDP 1
    • MDP-1
    • Mdp1
    • MGDP1_HUMAN
    see all
  • FunctionMagnesium-dependent phosphatase which may act as a tyrosine phosphatase.
  • Sequence similaritiesBelongs to the HAD-like hydrolase superfamily.
  • Information by UniProt

Recombinant Human MDP1 protein images

  • 15% SDS-PAGE analysis of 3 µg ab101631.

References for Recombinant Human MDP1 protein (ab101631)

ab101631 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101631.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"