Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMARLPKLAVFDLDYTLWPFWVDTHVD PPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEG ANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERR NIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA
    • Molecular weight
      23 kDa including tags
    • Amino acids
      1 to 176
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101631 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab101631 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • FN6Pase
    • Fructosamine-6-phosphatase
    • Magnesium dependent phosphatase 1
    • Magnesium-dependent phosphatase 1
    • MDP 1
    • MDP-1
    • Mdp1
    • MGDP1_HUMAN
    see all
  • Function
    Magnesium-dependent phosphatase which may act as a tyrosine phosphatase.
  • Sequence similarities
    Belongs to the HAD-like hydrolase superfamily.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab101631.

References

ab101631 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101631.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up