Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPAKVVELKNLELAAVRGSDVRVKMLAAPI NPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPAN AGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQ PGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLG AEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTM VTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLC DLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
    • Molecular weight
      37 kDa including tags
    • Amino acids
      54 to 373
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99325 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99325 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • AI195831
    • CGI 63
    • FASN2B
    • Homolog of yeast 2 enoyl thioester reductase
    • HsNrbf-1
    • HsNrbf1
    • mecr
    • MECR_HUMAN
    • mitochondrial
    • Mitochondrial 2 enoyl thioester reductase
    • NRBF 1
    • NRBF-1
    • NRBF1
    • Nuclear receptor binding factor 1
    • Nuclear receptor-binding factor 1
    • OTTMUSP00000009996
    • RP23-13A13.1
    • Trans 2 enoyl CoA reductase, mitochondrial
    • Trans-2-enoyl-CoA reductase
    see all
  • Function
    Catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH-dependent manner with preference to medium chain length substrate. May have a role in the mitochondrial synthesis of fatty acids.
  • Tissue specificity
    Highly expressed in skeletal and heart muscle. Expressed at lower level in placenta, liver, kidney and pancreas. Weakly or not expressed in lung.
  • Sequence similarities
    Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99325 (3µg).

References

ab99325 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99325.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up