Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BV79
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMPAKVVELKNLELAAVRGSDVRVKMLAAPI NPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPAN AGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQ PGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLG AEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTM VTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLC DLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
    • Molecular weight37 kDa including tags
    • Amino acids54 to 373
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99325 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99325 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • AI195831
    • CGI 63
    • FASN2B
    • Homolog of yeast 2 enoyl thioester reductase
    • HsNrbf-1
    • HsNrbf1
    • mecr
    • MECR_HUMAN
    • mitochondrial
    • Mitochondrial 2 enoyl thioester reductase
    • NRBF 1
    • NRBF-1
    • NRBF1
    • Nuclear receptor binding factor 1
    • Nuclear receptor-binding factor 1
    • OTTMUSP00000009996
    • RP23-13A13.1
    • Trans 2 enoyl CoA reductase, mitochondrial
    • Trans-2-enoyl-CoA reductase
    see all
  • FunctionCatalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH-dependent manner with preference to medium chain length substrate. May have a role in the mitochondrial synthesis of fatty acids.
  • Tissue specificityHighly expressed in skeletal and heart muscle. Expressed at lower level in placenta, liver, kidney and pancreas. Weakly or not expressed in lung.
  • Sequence similaritiesBelongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.
  • Cellular localizationMitochondrion.
  • Information by UniProt

Recombinant Human MECR protein images

  • 15% SDS-PAGE showing ab99325 (3µg).

References for Recombinant Human MECR protein (ab99325)

ab99325 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99325.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"