Overview

  • Product name
    Recombinant Human MEF2B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGG LAGPRGGLNTSRSLYSGLQNP
    • Molecular weight
      33 kDa including tags
    • Amino acids
      165 to 235

Specifications

Our Abpromise guarantee covers the use of ab114622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • MADS box transcription enhancer factor 2
    • MDS1 EVI1
    • Mef2b
    • MEF2B_HUMAN
    • Myocyte enhancer factor 2B
    • Myocyte specific enhancer factor 2B
    • Myocyte-specific enhancer factor 2B
    • PRDM3
    • RSRFR2
    • Serum response factor like protein 2
    • Serum response factor-like protein 2
    • XMEF2
    see all
  • Function
    Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific genes. Activates transcription via this element. May be involved in muscle-specific and/or growth factor-related transcription.
  • Tissue specificity
    Expressed in skeletal and cardiac muscle and brain.
  • Sequence similarities
    Belongs to the MEF2 family.
    Contains 1 MADS-box domain.
    Contains 1 Mef2-type DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human MEF2B protein images

  • ab114622 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human MEF2B protein (ab114622)

ab114622 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114622.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up