Overview

  • Product name
    Recombinant Human MEF2B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGG LAGPRGGLNTSRSLYSGLQNP
    • Molecular weight
      33 kDa including tags
    • Amino acids
      165 to 235

Specifications

Our Abpromise guarantee covers the use of ab114622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • MADS box transcription enhancer factor 2
    • MDS1 EVI1
    • Mef2b
    • MEF2B_HUMAN
    • Myocyte enhancer factor 2B
    • Myocyte specific enhancer factor 2B
    • Myocyte-specific enhancer factor 2B
    • PRDM3
    • RSRFR2
    • Serum response factor like protein 2
    • Serum response factor-like protein 2
    • XMEF2
    see all
  • Function
    Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific genes. Activates transcription via this element. May be involved in muscle-specific and/or growth factor-related transcription.
  • Tissue specificity
    Expressed in skeletal and cardiac muscle and brain.
  • Sequence similarities
    Belongs to the MEF2 family.
    Contains 1 MADS-box domain.
    Contains 1 Mef2-type DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab114622 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab114622 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114622.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up