Overview

  • Product name
    Recombinant Human MEF2C protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNS TNKLFQYASTDMDKVLLKYTEYNEQ HESRTNSDIVETLRKKGLNGCDS PDPDADDSVGHSPESEDKYRKINEDIDLMISRQRLCAVPPPNFEMPVSIP VS SHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNT GGLMGGDLTSGAGTSAGNGYGNPRNSPGL LVSPGNLNKNMQAKSPPPM NLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATP VVSVAT PTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASAL HLGSVTGWQQQHLHNMQPSALSQLGACTSTHLS QSSNLSLPSTQSLNI KSEPVSPPRDRTTTPSRYPQHTRHEAGRSPVDSLSSCSSSYDGSDREDHR NEFHSPIGLT RPSPDERESPSVKRMRLSE
    • Molecular weight
      78 kDa including tags
    • Amino acids
      1 to 469

Specifications

Our Abpromise guarantee covers the use of ab114241 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C5DELq14.3
    • DEL5q14.3
    • MADS box transcription enhancer factor 2 polypeptide C (myocyte enhancer factor 2C)
    • MADS box transcription enhancer factor 2, polypeptide C
    • MEF2C
    • MEF2C_HUMAN
    • Myocyte enhancer factor 2C
    • Myocyte specific enhancer factor 2C
    • Myocyte-specific enhancer factor 2C
    • OTTHUMP00000222409
    • Similar to MADS box transcription enhancer factor 2 polypeptide C
    see all
  • Function
    Transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. Controls cardiac morphogenesis and myogenesis, and is also involved in vascular development. Plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission. Crucial for normal neuronal development, distribution, and electrical activity in the neocortex. Necessary for proper development of megakaryocytes and platelets and for bone marrow B lymphopoiesis. Required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B cells. May also be involved in neurogenesis and in the development of cortical architecture (By similarity). Isoform 3 and isoform 4, which lack the repressor domain, are more active than isoform 1 and isoform 2.
  • Tissue specificity
    Expressed in brain and skeletal muscle.
  • Involvement in disease
    Defects in MEF2C are the cause of mental retardation-stereotypic movements-epilepsy and/or cerebral malformations (MRSME) [MIM:613443]. It is a disorder characterized by severe mental retardation, absent speech, hypotonia, poor eye contact and stereotypic movements. Dysmorphic features include high broad forehead with variable small chin, short nose with anteverted nares, large open mouth, upslanted palpebral fissures and prominent eyebrows. Some patients have seizures.
  • Sequence similarities
    Belongs to the MEF2 family.
    Contains 1 MADS-box domain.
    Contains 1 Mef2-type DNA-binding domain.
  • Developmental stage
    Expression is highest during the early stages of postnatal development, at later stages levels greatly decrease.
  • Domain
    The beta domain, missing in a number of isoforms, is required for enhancement of transcriptional activity.
  • Post-translational
    modifications
    Phosphorylation on Ser-59 enhances DNA binding activity (By similarity). Phosphorylation on Ser-396 is required for Lys-391 sumoylation and inhibits transcriptional activity.
    Acetylated by p300 on several sites in diffentiating myocytes. Acetylation on Lys-4 increases DNA binding and transactivation.
    Sumoylated on Lys-391 by SUMO2 but not by SUMO1 represses transcriptional activity.
    Proteolytically cleaved in cerebellar granule neurons, probably by caspase 7, following neurotoxicity. Preferentially cleaves the CDK5-mediated hyperphosphorylated form which leads to neuron apoptosis and transcriptional inactivation.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114241 at approximately 77.66kDa stained with Coomassie Blue.

References

ab114241 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114241.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up