Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      THSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGVSQSTH SLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFS
    • Molecular weight
      36 kDa including tags
    • Amino acids
      256 to 351

Specifications

Our Abpromise guarantee covers the use of ab152521 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686I1536
    • MADS box transcription factor 2 polypeptide D
    • Mef2d
    • MEF2D_HUMAN
    • Myocyte enhancer factor 2D
    • Myocyte specific enhancer factor 2, polypeptide D
    • Myocyte specific enhancer factor 2D
    • Myocyte-specific enhancer factor 2D
    see all
  • Function
    Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific, growth factor- and stress-induced genes. Mediates cellular functions not only in skeletal and cardiac muscle development, but also in neuronal differentiation and survival. Plays diverse roles in the control of cell growth, survival and apoptosis via p38 MAPK signaling in muscle-specific and/or growth factor-related transcription. Plays a critical role in the regulation of neuronal apoptosis.
  • Sequence similarities
    Belongs to the MEF2 family.
    Contains 1 MADS-box domain.
    Contains 1 Mef2-type DNA-binding domain.
  • Developmental stage
    Present in myotubes and also in undifferentiated myoblasts.
  • Domain
    The beta domain, missing in a number of isoforms, is required for enhancement of transcriptional activity.
  • Post-translational
    modifications
    Phosphorylated on Ser-444 by CDK5 is required for Lys-439 sumoylation and inhibits transcriptional activity. In neurons, enhanced CDK5 activity induced by neurotoxins promotes caspase 3-mediated cleavage leading to neuron apoptosis. Phsophorylation on Ser-180 can be enhanced by EGF.
    Acetylated on Lys-439 by CREBBP. Deacetylated by SIRT1.
    Sumoylated on Lys-439 by SUMO2 but not SUMO1; which inhibits transcriptional activity and myogenic activity. Desumoylated by SENP3.
    Proteolytically cleaved in cerebellar granule neurons on several sites by caspase 7 following neurotoxicity. Preferentially cleaves the CDK5-mediated hyperphosphorylated form which leads to neuron apoptosis and transcriptional inactivation.
  • Cellular localization
    Nucleus. Translocated by HDAC4 to nuclear dots.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152521 stained with Coomassie Blue.

References

ab152521 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152521.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up