Overview

  • Product name
    Recombinant Human MEI1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLALTLAKADSPRTALLCSAWLLTASFSAQQHKGSLQVHQTLSVEMDQVL KALSFPKKKAALLSAAILCFLRTALRQSFSSALVALVPSGAQPLPATKDT VLAPLRMSQVRSLVIGLQNLLVQKDPLLSQACVGCLEALLDYLDARSPDI ALHVASQPWNRFLLFTLLDAGENSFLRPEILRLMTLLQSMGHLADHSMAQ TLQASLEGLPPSTSSGQPPLQDMLCLGGVAVSLSHIRN
    • Amino acids
      1 to 238
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165607 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4932408F18Rik
    • MEI 1
    • MEI1, mouse, homolog of
    • Meiosis defective 1
    • Meiosis defective protein 1
    • Meiosis inhibitor 1
    • Meiosis inhibitor protein 1
    • MGC40042
    • OTTHUMP00000028520
    • RP5-821D11.2
    • similar to mouse meiosis defective 1 gene
    • SPATA38
    • spermatogenesis associated 38
    see all
  • Relevance
    MEI1 is required for normal meiotic chromosome synapsis. It may be involved in the formation of meiotic double-strand breaks (DSBs) in spermatocytes. There are 7 known isoforms.

Images

  • ab165607 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165607 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165607.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up