Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO00470
    • SpeciesHuman
    • SequenceMAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQY PHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCT PREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQ VLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSED ITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDG LDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYP SEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNP DGQPMGGFVMDGQQHMGIRAPGKTLFLW
    • Molecular weight68 kDa including tags
    • Amino acids1 to 378
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • Homeo box protein Meis1
    • Homeobox protein Meis1
    • Leukemogenic homolog protein
    • MEIS 1
    • Meis homeo box 1
    • Meis homeobox 1
    • Meis1
    • Meis1 mouse homolog
    • Meis1 myeloid ecotropic viral integration site 1 homolog
    • Meis1 myeloid ecotropic viral integration site 1 homolog mouse
    • MEIS1 protein
    • MEIS1_HUMAN
    • MGC43380
    • Myeloid ecotropic viral integration site 1 homolog
    • WUGSC:H NH0444B04.1
    see all
  • FunctionActs as a transcriptional regulator of PAX6. Acts as a transcriptional activator of PF4 in complex with PBX1 or PBX2. Required for hematopoiesis, megakaryocyte lineage development and vascular patterning. May function as a cofactor for HOXA7 and HOXA9 in the induction of myeloid leukemias.
  • Tissue specificityExpressed at low level in normal immunohepatopoietic tissues, including the fetal liver. Expressed in a subset of myeloid leukemia cell lines, with the highest expression seen in those with a megakaryocytic-erythroid phenotype. Also expressed at high levels in the cerebellum.
  • Involvement in diseaseDefects in MEIS1 could be a cause of susceptibility to restless legs syndrome type 7 (RLS7) [MIM:612853]. Restless legs syndrome (RLS) is a neurologic sleep/wake disorder characterized by uncomfortable and unpleasant sensations in the legs that appear at rest, usually at night, inducing an irresistible desire to move the legs. The disorder results in nocturnal insomnia and chronic sleep deprivation.
  • Sequence similaritiesBelongs to the TALE/MEIS homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human MEIS1 protein images

  • ab112320 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human MEIS1 protein (ab112320)

ab112320 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112320.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"