Recombinant Human MEIS1 protein (ab112321)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: SDS-PAGE, ELISA, WB
Description
-
Product name
Recombinant Human MEIS1 protein -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQY PHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALI -
Predicted molecular weight
36 kDa including tags -
Amino acids
1 to 90 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab112321 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
ELISA
Western blot
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Homeo box protein Meis1
- Homeobox protein Meis1
- Leukemogenic homolog protein
see all -
Function
Acts as a transcriptional regulator of PAX6. Acts as a transcriptional activator of PF4 in complex with PBX1 or PBX2. Required for hematopoiesis, megakaryocyte lineage development and vascular patterning. May function as a cofactor for HOXA7 and HOXA9 in the induction of myeloid leukemias. -
Tissue specificity
Expressed at low level in normal immunohepatopoietic tissues, including the fetal liver. Expressed in a subset of myeloid leukemia cell lines, with the highest expression seen in those with a megakaryocytic-erythroid phenotype. Also expressed at high levels in the cerebellum. -
Involvement in disease
Defects in MEIS1 could be a cause of susceptibility to restless legs syndrome type 7 (RLS7) [MIM:612853]. Restless legs syndrome (RLS) is a neurologic sleep/wake disorder characterized by uncomfortable and unpleasant sensations in the legs that appear at rest, usually at night, inducing an irresistible desire to move the legs. The disorder results in nocturnal insomnia and chronic sleep deprivation. -
Sequence similarities
Belongs to the TALE/MEIS homeobox family.
Contains 1 homeobox DNA-binding domain. -
Cellular localization
Nucleus. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab112321 has not yet been referenced specifically in any publications.