Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAPSPSGGGGSGGGRGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFAN PPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAE
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159496 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • c Jun N terminal kinase kinase 1
    • C-JUN N-terminal kinase kinase 1
    • Dual specificity mitogen activated protein kinase kinase 4
    • Dual specificity mitogen-activated protein kinase kinase 4
    • JNK Activated Kinase 1
    • JNK activating kinase 1
    • JNK-activating kinase 1
    • JNKK
    • JNKK1
    • MAP kinase kinase 4
    • Map2k4
    • MAPK ERK kinase 4
    • MAPK/ERK kinase 4
    • MAPKK 4
    • MAPKK4
    • MEK 4
    • MEK4
    • Mitogen activated protein kinase kinase 4
    • MKK 4
    • MKK4
    • MP2K4_HUMAN
    • PRKMK4
    • SAPK ERK kinase 1
    • SAPK/ERK kinase 1
    • SAPKK 1
    • SAPKK1
    • SEK1
    • SERK1
    • SKK1
    • Stress activated protein kinase kinase 1
    see all
  • Function
    Dual specificity kinase that activates the JUN kinases MAPK8 (JNK1) and MAPK9 (JNK2) as well as MAPK14 (p38) but not MAPK1 (ERK2) or MAPK3 (ERK1).
  • Tissue specificity
    Abundant expression is seen in the skeletal muscle. It is also widely expressed in other tissues.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Activated by phosphorylation on Ser/Thr by MAP kinase kinase kinases.
  • Information by UniProt

Images

  • ab159496 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159496 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159496.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up