Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13163
    • SpeciesHuman
    • SequenceMLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQ VLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIE PLQIFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSLPSNSLKKSSA ELKKILANGQMNEQDIRYRDTLGHGNGGTVYKAYHVPSGKILAVKVILLD ITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISICTEFMDGGSLD VYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELA LGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGESSEPFVHFITQCM RKQPKERPAPEELMGHPFIVQFNDGNAAVVSMWVCRALEERRSQQGPP
    • Molecular weight75 kDa including tags
    • Amino acids1 to 448

Specifications

Our Abpromise guarantee covers the use of ab114459 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114459 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Dual specificity mitogen activated protein kinase kinase 5
    • Dual specificity mitogen-activated protein kinase kinase 5
    • EC 2.7.12.2
    • HsT17454
    • MAP kinase kinase 5
    • MAP kinase kinase MEK5b
    • MAP2K5
    • MAPK/ERK kinase 5
    • MAPKK 5
    • MAPKK5
    • MEK 5
    • mitogen-activated protein kinase kinase 5
    • MKK5
    • MP2K5_HUMAN
    • PRKMK5
    • Protein kinase, mitogen-activated, kinase 5
    • SAPKK5
    • SKK5
    see all
  • FunctionActs as a scaffold for the formation of a ternary MAP3K2/MAP3K3-MAP3K5-MAPK7 signaling complex. Activation of this pathway appear to play a critical role in protecting cells from stress-induced apopotosis, neuronal survival and cardiac development and angiogenesis.
  • Tissue specificityExpressed in many adult tissues. Abundant in heart and skeletal muscle.
  • Sequence similaritiesBelongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.
    Contains 1 OPR domain.
    Contains 1 protein kinase domain.
  • DomainBinds MAP3K2/MAP3K3 and MAPK7 via non-overlapping residues of the OPR domain. This domain also mediates interactions with SQSTM1 and PARD6A.
  • Post-translational
    modifications
    Activated by phosphorylation on Ser/Thr by MAP kinase kinase kinases.
    Yersinia yopJ may acetylate Ser/Thr residues, preventing phosphorylation and activation, thus blocking the MAPK signaling pathway.
  • Information by UniProt

Recombinant Human MEK5 protein images

  • ab114459 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human MEK5 protein (ab114459)

ab114459 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114459.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"