Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQ VLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIE PLQIFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSLPSNSLKKSSA ELKKILANGQMNEQDIRYRDTLGHGNGGTVYKAYHVPSGKILAVKVILLD ITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISICTEFMDGGSLD VYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELA LGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGESSEPFVHFITQCM RKQPKERPAPEELMGHPFIVQFNDGNAAVVSMWVCRALEERRSQQGPP
    • Molecular weight
      75 kDa including tags
    • Amino acids
      1 to 448

Specifications

Our Abpromise guarantee covers the use of ab114459 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114459 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Dual specificity mitogen activated protein kinase kinase 5
    • Dual specificity mitogen-activated protein kinase kinase 5
    • EC 2.7.12.2
    • HsT17454
    • MAP kinase kinase 5
    • MAP kinase kinase MEK5b
    • MAP2K5
    • MAPK/ERK kinase 5
    • MAPKK 5
    • MAPKK5
    • MEK 5
    • mitogen-activated protein kinase kinase 5
    • MKK5
    • MP2K5_HUMAN
    • PRKMK5
    • Protein kinase, mitogen-activated, kinase 5
    • SAPKK5
    • SKK5
    see all
  • Function
    Acts as a scaffold for the formation of a ternary MAP3K2/MAP3K3-MAP3K5-MAPK7 signaling complex. Activation of this pathway appear to play a critical role in protecting cells from stress-induced apopotosis, neuronal survival and cardiac development and angiogenesis.
  • Tissue specificity
    Expressed in many adult tissues. Abundant in heart and skeletal muscle.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.
    Contains 1 OPR domain.
    Contains 1 protein kinase domain.
  • Domain
    Binds MAP3K2/MAP3K3 and MAPK7 via non-overlapping residues of the OPR domain. This domain also mediates interactions with SQSTM1 and PARD6A.
  • Post-translational
    modifications
    Activated by phosphorylation on Ser/Thr by MAP kinase kinase kinases.
    Yersinia yopJ may acetylate Ser/Thr residues, preventing phosphorylation and activation, thus blocking the MAPK signaling pathway.
  • Information by UniProt

Images

  • ab114459 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab114459 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114459.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up