Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPA DKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKL ILGD
    • Amino acids
      231 to 334
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159221 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dual specificity mitogen activated protein kinase kinase 6
    • Dual specificity mitogen-activated protein kinase kinase 6
    • MAP kinase kinase 6
    • MAP2K6
    • MAPK/ERK kinase 6
    • MAPKK 6
    • MAPKK6
    • MEK 6
    • MEK6
    • Mitogen Activated Protein Kinase Kinase 6
    • MKK 6
    • MKK6
    • MP2K6_HUMAN
    • PRKMK6
    • Protein kinase mitogen activated kinase 6
    • protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6)
    • SAPK kinase 3
    • SAPKK-3
    • SAPKK3
    • SKK3
    • Stress-activated protein kinase kinase 3
    see all
  • Function
    Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in MAP kinase p38 exclusively.
  • Tissue specificity
    Isoform 2 is only expressed in skeletal muscle. Isoform 1 is expressed in skeletal muscle, heart, and in lesser extent in liver or pancreas.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Weakly autophosphorylated.
    Acetylation of Ser-207 and Thr-211 by Yersinia yopJ prevents phosphorylation and activation, thus blocking the MAPK signaling pathway.
  • Information by UniProt

Images

  • ab159221 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159221 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159221.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up