Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLAND GGSRSPSSESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIM KQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQ MRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMG TCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNIL LDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD IRADVWSLGISLPCPSPSQVELATGQFPYKNCKTDFEVLTKVLQEEPPLL PGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASW FKDVMAKTESPRTSGVLSQPHLPFFR
    • Amino acids
      1 to 426
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159222 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • c-Jun N-terminal kinase kinase 2
    • Dual specificity mitogen activated protein kinase kinase 7
    • Dual specificity mitogen-activated protein kinase kinase 7
    • JNK activating kinase 2
    • JNK kinase 2
    • JNK-activating kinase 2
    • JNKK 2
    • Jnkk-2
    • Jnkk2
    • MAP kinase kinase 7
    • MAP2K7
    • MAPK/ERK kinase 7
    • MAPKK 7
    • MAPKK-7
    • MAPKK7
    • MEK 7
    • Mitogen Activated Protein Kinase kinase 7
    • MKK 7
    • MKK-7
    • MKK7
    • MP2K7_HUMAN
    • PRKMK 7
    • PRKMK-7
    • PRKMK7
    • SAPK kinase 4
    • SAPKK-4
    • SAPKK4
    • Sek 2
    • Sek-2
    • Sek2
    • SKK4
    • stress-activated protein kinase kinase 4
    see all
  • Function
    Stress activated, dual specificity kinase that activates the JUN kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3.
  • Tissue specificity
    Ubiquitous; with highest level of expression in skeletal muscle. Isoform 3 is found at low levels in placenta, fetal liver, and skeletal muscle.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Activated by phosphorylation on Ser/Thr.
  • Cellular localization
    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • ab159222 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159222 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159222.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up