Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNT ELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1077 to 1176

Specifications

Our Abpromise guarantee covers the use of ab152522 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • M3K1_HUMAN
    • MAP3K1
    • MAPK/ERK kinase kinase 1
    • MAPKKK1
    • MEK kinase 1
    • Mekk
    • MEKK 1
    • MEKK1
    • Mitogen activated protein kinase kinase kinase 1
    • Mitogen activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase
    • Mitogen-activated protein kinase kinase kinase 1
    • SRXY6
    see all
  • Function
    Component of a protein kinase signal transduction cascade. Activates the ERK and JNK kinase pathways by phosphorylation of MAP2K1 and MAP2K4. Activates CHUK and IKBKB, the central protein kinases of the NF-kappa-B pathway.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 1 protein kinase domain.
    Contains 1 RING-type zinc finger.
    Contains 1 SWIM-type zinc finger.
  • Post-translational
    modifications
    Autophosphorylated.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152522 stained with Coomassie Blue.

References

ab152522 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152522.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up