Recombinant Human MelanA protein (ab114312)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16655
    • SpeciesHuman
    • SequenceMPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRR RNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNA PPAYEKLSAEQSPPPYSP
    • Molecular weight39 kDa including tags
    • Amino acids1 to 118

Specifications

Our Abpromise guarantee covers the use of ab114312 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Antigen LB39 AA
    • Antigen LB39-AA
    • Antigen SK29 AA
    • Antigen SK29-AA
    • MAR1_HUMAN
    • MART 1
    • MART-1
    • MART1
    • Melan A
    • Melan A protein
    • Melanoma antigen recognized by T cells 1
    • Melanoma antigen recognized by T-cells 1
    • MLAN A
    • MLANA
    • OTTHUMP00000021036
    • OTTHUMP00000021037
    • OTTHUMP00000021038
    • Protein Melan-A
    see all
  • FunctionInvolved in melanosome biogenesis by ensuring the stability of GPR143. Plays a vital role in the expression, stability, trafficking, and processing of melanocyte protein PMEL, which is critical to the formation of stage II melanosomes.
  • Tissue specificityExpression is restricted to melanoma and melanocyte cell lines and retina.
  • Post-translational
    modifications
    Acylated.
  • Cellular localizationEndoplasmic reticulum membrane. Golgi apparatus. Golgi apparatus > trans-Golgi network membrane. Melanosome. Also found in small vesicles and tubules dispersed over the entire cytoplasm. A small fraction of the protein is inserted into the membrane in an inverted orientation. Inversion of membrane topology results in the relocalization of the protein from a predominant Golgi/post-Golgi area to the endoplasmic reticulum. Melanoma cells expressing the protein with an inverted membrane topology are more effectively recognized by specific cytolytic T-lymphocytes than those expressing the protein in its native membrane orientation.
  • Information by UniProt

Recombinant Human MelanA protein images

  • SDS-PAGE analysis of ab114312 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human MelanA protein (ab114312)

ab114312 has not yet been referenced specifically in any publications.

Product Wall

Please note that ab38124 is not a full length protein but a recombinant fragment, corresponding to amino acids 1-150 of Human Melanoma gp100.

As for the stimulation assays, unfortunately we have not tested these proteins in stimulation assays...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"