Recombinant Human MelanA protein (ab157272)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSCRRRNGYRALMDKSLHVGTQCALTRRC PQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
    • Molecular weight
      10 kDa including tags
    • Amino acids
      48 to 118
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157272 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab157272 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • Antigen LB39 AA
    • Antigen LB39-AA
    • Antigen SK29 AA
    • Antigen SK29-AA
    • MAR1_HUMAN
    • MART 1
    • MART-1
    • MART1
    • Melan A
    • Melan A protein
    • Melanoma antigen recognized by T cells 1
    • Melanoma antigen recognized by T-cells 1
    • MLAN A
    • MLANA
    • OTTHUMP00000021036
    • OTTHUMP00000021037
    • OTTHUMP00000021038
    • Protein Melan-A
    see all
  • Function
    Involved in melanosome biogenesis by ensuring the stability of GPR143. Plays a vital role in the expression, stability, trafficking, and processing of melanocyte protein PMEL, which is critical to the formation of stage II melanosomes.
  • Tissue specificity
    Expression is restricted to melanoma and melanocyte cell lines and retina.
  • Post-translational
    modifications
    Acylated.
  • Cellular localization
    Endoplasmic reticulum membrane. Golgi apparatus. Golgi apparatus > trans-Golgi network membrane. Melanosome. Also found in small vesicles and tubules dispersed over the entire cytoplasm. A small fraction of the protein is inserted into the membrane in an inverted orientation. Inversion of membrane topology results in the relocalization of the protein from a predominant Golgi/post-Golgi area to the endoplasmic reticulum. Melanoma cells expressing the protein with an inverted membrane topology are more effectively recognized by specific cytolytic T-lymphocytes than those expressing the protein in its native membrane orientation.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab157272 (3µg).

References

ab157272 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157272.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up