Recombinant human Melanoma Inhibitory Activity protein (ab73232)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      M-GPMPKLADRKLCADQECSSHPISMAVALQDYMAPDCRFLTIHRGQVV YVFSLKGRGRFLWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKVDVKT DKWDFYCQ.
    • Amino acids
      25 to 131

Specifications

Our Abpromise guarantee covers the use of ab73232 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Calculated by the inhibiting effect on the invasion of Mel In Tumor cells (Bosserhoff et al.2003 Lab Invest. 83, 1583-94).

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    > 95 % SDS-PAGE.
    This protein was purified by proprietary chromatographic techniques. Purity greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20mM Potassium phosphate, 150mM Potassium chloride, pH 7.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in sterile 18Mohm-cm water to at not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

General Info

  • Alternative names
    • Cartilage derived retinoic acid sensitive protein
    • CD RAP
    • CDRAP
    • Melanoma derived growth regulatory protein precursor
    • Melanoma inhibitory activity protein
    • Melanoma-derived growth regulatory protein
    • Mia
    • MIA_HUMAN
    see all
  • Function
    Elicits growth inhibition on melanoma cells in vitro as well as some other neuroectodermal tumors, including gliomas.
  • Tissue specificity
    All malignant melanoma cell lines tested and infrequently in glioma cell lines.
  • Sequence similarities
    Belongs to the MIA/OTOR family.
    Contains 1 SH3 domain.
  • Post-translational
    modifications
    May possess two intramolecular disulfide bonds.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab73232 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab73232.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up