Recombinant human Melanoma Inhibitory Activity protein (ab73232)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceM-GPMPKLADRKLCADQECSSHPISMAVALQDYMAPDCRFLTIHRGQVV YVFSLKGRGRFLWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKVDVKT DKWDFYCQ.
    • Amino acids25 to 131

Specifications

Our Abpromise guarantee covers the use of ab73232 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Calculated by the inhibiting effect on the invasion of Mel In Tumor cells (Bosserhoff et al.2003 Lab Invest. 83, 1583-94).

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity> 95 % SDS-PAGE.
    This protein was purified by proprietary chromatographic techniques. Purity greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20mM Potassium phosphate, 150mM Potassium chloride, pH 7.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionReconstitute in sterile 18Mohm-cm water to at not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

General Info

  • Alternative names
    • Cartilage derived retinoic acid sensitive protein
    • CD RAP
    • CDRAP
    • Melanoma derived growth regulatory protein precursor
    • Melanoma inhibitory activity protein
    • Melanoma-derived growth regulatory protein
    • Mia
    • MIA_HUMAN
    see all
  • FunctionElicits growth inhibition on melanoma cells in vitro as well as some other neuroectodermal tumors, including gliomas.
  • Tissue specificityAll malignant melanoma cell lines tested and infrequently in glioma cell lines.
  • Sequence similaritiesBelongs to the MIA/OTOR family.
    Contains 1 SH3 domain.
  • Post-translational
    modifications
    May possess two intramolecular disulfide bonds.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant human Melanoma Inhibitory Activity protein (ab73232)

ab73232 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab73232.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"