Recombinant Human Melatonin Receptor 1A protein (ab114688)

Overview

  • Product name
    Recombinant Human Melatonin Receptor 1A protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVV KVDSV
    • Molecular weight
      32 kDa including tags
    • Amino acids
      296 to 350

Specifications

Our Abpromise guarantee covers the use of ab114688 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Mel 1A R
    • MEL-1A-R
    • Mel1a melatonin receptor
    • Mel1a receptor
    • Melatonin receptor 1A
    • Melatonin receptor type 1A
    • MelR
    • MR
    • MT 1
    • MT1
    • MTNR 1A
    • MTNR1A
    • MTR1A_HUMAN
    see all
  • Function
    High affinity receptor for melatonin. Likely to mediates the reproductive and circadian actions of melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibit adenylate cyclase activity.
  • Tissue specificity
    Expressed in hypophyseal pars tuberalis and hypothalamic suprachiasmatic nuclei (SCN). Hippocampus.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human Melatonin Receptor 1A protein images

  • ab114688 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Melatonin Receptor 1A protein (ab114688)

ab114688 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114688.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up