Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQ TQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSC K
    • Amino acids
      550 to 650
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153020 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI327312
    • hMELK
    • HPK 38
    • hPK38
    • KIAA0175
    • Likely ortholog of maternal embryonic leucine zipper kinase
    • Maternal embryonic leucine zipper kinase
    • MELK
    • MELK_HUMAN
    • mKIAA0175
    • MPK38
    • OTTHUMP00000021377
    • OTTHUMP00000046113
    • pEg3 kinase
    • Protein kinase Eg3
    • Protein kinase PK38
    • RP23 382O11.1
    • Tyrosine protein kinase MELK
    see all
  • Function
    Phosphorylates ZNF622 and may contribute to its redirection to the nucleus. May be involved in the inhibition of spliceosome assembly during mitosis.
  • Tissue specificity
    Expressed in placenta, kidney, thymus, testis, ovary and intestine.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily.
    Contains 1 KA1 (kinase-associated) domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated. Thr-478 phosphorylation during mitosis promotes interaction with PPP1R8.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab153020 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153020 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153020.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up