Recombinant Human MEOX 2 protein (ab114829)

Overview

  • Product nameRecombinant Human MEOX 2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ6FHY5
    • SpeciesHuman
    • SequenceMEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCII AGYPNEEGMFASQHHRGHHHHHHHHHHHHQQQQHQALQTNWHLPQMSSPP SAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYGR QALSPAEAEKRSGGKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRE LEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQG AAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSIANEDSHDSDHSSEH AHL
    • Molecular weight59 kDa including tags
    • Amino acids1 to 303

Specifications

Our Abpromise guarantee covers the use of ab114829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GAX
    • Growth arrest-specific homeobox
    • Homeobox protein MOX 2
    • Homeobox protein MOX-2
    • meox2
    • MEOX2_HUMAN
    • Mesenchyme homeobox 2
    • MOX2
    see all
  • FunctionRole in mesoderm induction and its earliest regional specification, somitogenesis, and myogenic and sclerotomal differentiation. May have a regulatory role when quiescent vascular smooth muscle cells reenter the cell cycle.
  • Tissue specificityEmbryo and placenta.
  • Sequence similaritiesContains 1 homeobox DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human MEOX 2 protein images

  • ab114829 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human MEOX 2 protein (ab114829)

ab114829 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"