Recombinant Human MEOX 2 protein (ab114829)

Overview

  • Product name
    Recombinant Human MEOX 2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCII AGYPNEEGMFASQHHRGHHHHHHHHHHHHQQQQHQALQTNWHLPQMSSPP SAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYGR QALSPAEAEKRSGGKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRE LEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQG AAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSIANEDSHDSDHSSEH AHL
    • Molecular weight
      59 kDa including tags
    • Amino acids
      1 to 303

Specifications

Our Abpromise guarantee covers the use of ab114829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GAX
    • Growth arrest-specific homeobox
    • Homeobox protein MOX 2
    • Homeobox protein MOX-2
    • meox2
    • MEOX2_HUMAN
    • Mesenchyme homeobox 2
    • MOX2
    see all
  • Function
    Role in mesoderm induction and its earliest regional specification, somitogenesis, and myogenic and sclerotomal differentiation. May have a regulatory role when quiescent vascular smooth muscle cells reenter the cell cycle.
  • Tissue specificity
    Embryo and placenta.
  • Sequence similarities
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human MEOX 2 protein images

  • ab114829 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human MEOX 2 protein (ab114829)

ab114829 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up