Recombinant Human Mesothelin protein (ab185274)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LAGETGQEAAPLDGVLANPPNISSLSPRQLLGFPCAEVSGLSTERVRELA VALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQA CTRFFSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADVRALG GLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGP PSTWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPER
    • Molecular weight
      28 kDa including tags
    • Amino acids
      37 to 286
    • Tags
      His tag C-Terminus
    • Additional sequence information
      AAH09272.

Specifications

Our Abpromise guarantee covers the use of ab185274 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • CAK 1
    • CAK1
    • CAK1 antigen
    • cleaved form
    • Megakaryocyte potentiating factor
    • Mesothelin
    • Mesothelin isoform 1 precursor
    • MPF
    • Msln
    • MSLN_HUMAN
    • Pre pro megakaryocyte potentiating factor
    • Pre-pro-megakaryocyte-potentiating factor
    • SMR
    • SMRP
    • Soluble MPF mesothelin related protein
    see all
  • Function
    Membrane-anchored forms may play a role in cellular adhesion.
    Megakaryocyte-potentiating factor (MPF) potentiates megakaryocyte colony formation in vitro.
  • Tissue specificity
    Expressed in lung. Expressed at low levels in heart, placenta and kidney. Expressed in mesothelial cells. Highly expressed in mesotheliomas, ovarian cancers, and some squamous cell carcinomas (at protein level).
  • Involvement in disease
    Note=Antibodies against MSLN are detected in patients with mesothelioma and ovarian cancer.
  • Sequence similarities
    Belongs to the mesothelin family.
  • Post-translational
    modifications
    Both MPF and the cleaved form of mesothelin are N-glycosylated.
    Proteolytically cleaved by a furin-like convertase to generate megakaryocyte-potentiating factor (MPF), and the cleaved form of mesothelin.
  • Cellular localization
    Secreted and Cell membrane. Golgi apparatus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab185274 stained overnight with Coomassie Blue. DTT-reduced Protein migrates as 32 kDa due to glycosylation.

References

ab185274 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185274.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up