Overview

  • Product name
    Recombinant Human MEST protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFF TYKGLRIFYQDSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLRFHRVI ALDFLGFGFSDKPRPHHYSIFEQASIVEALLRHLGLQNRRINLLSHDYGD IVAQELLYRYKQNRSGRLTIKSLCLSNGGIFPETHRPLLLQKLLKDGGVL SPILTRLMNFFVFSRGLTPVFGPYTRPSESELWDMWAGIRNNDGNLVIDS LLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPVNPYPEFLELYRKTL PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF
    • Molecular weight
      63 kDa including tags
    • Amino acids
      1 to 335
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116871 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686L18234
    • EC 3.-.-.-
    • Mesoderm specific transcript (mouse) homolog
    • Mesoderm specific transcript homolog (mouse)
    • Mesoderm-specific transcript homolog protein
    • MEST
    • MEST_HUMAN
    • MGC111102
    • MGC8703
    • OTTHUMP00000210362
    • OTTHUMP00000210364
    • OTTHUMP00000210367
    • Paternally expressed gene 1
    • Paternally-expressed gene 1 protein
    • PEG1
    see all
  • Tissue specificity
    Highly expressed in hydatidiform moles, but barely expressed in dermoid cysts. Biallelic expression is detected in blood lymphocytes. Seems to imprinted in an isoform-specific manner rather than in a tissue-specific manner in lymphocytes. Isoform 1 is expressed only from the paternal allele. Isoform 2 is expressed from both the paternal allele and the maternal allele.
  • Sequence similarities
    Belongs to the AB hydrolase superfamily.
  • Developmental stage
    Monoallelic expression of paternally derived allele was observed in all fetal tissues examined, including brain, skeletal muscle, kidney, adrenal, tongue, heart, skin and placenta. In 75-day fetus, expressed in the amnion, brain, heart, lung, stomach, gut, adrenal, kidney, muscle and liver.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE gel showing ab116871, at approximately 62.92kDa, stained with Coomassie Blue.

References

ab116871 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116871.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up