Overview

  • Product nameRecombinant Human MEST protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ5EB52
    • SpeciesHuman
    • SequenceMVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFF TYKGLRIFYQDSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLRFHRVI ALDFLGFGFSDKPRPHHYSIFEQASIVEALLRHLGLQNRRINLLSHDYGD IVAQELLYRYKQNRSGRLTIKSLCLSNGGIFPETHRPLLLQKLLKDGGVL SPILTRLMNFFVFSRGLTPVFGPYTRPSESELWDMWAGIRNNDGNLVIDS LLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPVNPYPEFLELYRKTL PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF
    • Molecular weight63 kDa including tags
    • Amino acids1 to 335

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116871 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686L18234
    • EC 3.-.-.-
    • Mesoderm specific transcript (mouse) homolog
    • Mesoderm specific transcript homolog (mouse)
    • Mesoderm-specific transcript homolog protein
    • MEST
    • MEST_HUMAN
    • MGC111102
    • MGC8703
    • OTTHUMP00000210362
    • OTTHUMP00000210364
    • OTTHUMP00000210367
    • Paternally expressed gene 1
    • Paternally-expressed gene 1 protein
    • PEG1
    see all
  • Tissue specificityHighly expressed in hydatidiform moles, but barely expressed in dermoid cysts. Biallelic expression is detected in blood lymphocytes. Seems to imprinted in an isoform-specific manner rather than in a tissue-specific manner in lymphocytes. Isoform 1 is expressed only from the paternal allele. Isoform 2 is expressed from both the paternal allele and the maternal allele.
  • Sequence similaritiesBelongs to the AB hydrolase superfamily.
  • Developmental stageMonoallelic expression of paternally derived allele was observed in all fetal tissues examined, including brain, skeletal muscle, kidney, adrenal, tongue, heart, skin and placenta. In 75-day fetus, expressed in the amnion, brain, heart, lung, stomach, gut, adrenal, kidney, muscle and liver.
  • Cellular localizationEndoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human MEST protein images

  • 12.5% SDS-PAGE gel showing ab116871, at approximately 62.92kDa, stained with Coomassie Blue.

References for Recombinant Human MEST protein (ab116871)

ab116871 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116871.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"