Recombinant Human Metabotropic Glutamate Receptor 1 protein (ab114707)

Overview

  • Product name
    Recombinant Human Metabotropic Glutamate Receptor 1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHV GLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQY
    • Molecular weight
      37 kDa including tags
    • Amino acids
      387 to 486

Specifications

Our Abpromise guarantee covers the use of ab114707 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Glutamate receptor metabotropic 1
    • glutamate receptor, metabotropic 1
    • GPRC1A
    • GRM1
    • GRM1-Alpha
    • GRM1_HUMAN
    • GRM1A
    • Metabotropic glutamate receptor 1
    • mGlu1
    • mGluR1
    • MGLUR1-Alpha
    • MGLUR1A
    • SCAR13
    see all
  • Function
    Receptor for glutamate. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. May participate in the central action of glutamate in the CNS, such as long-term potentiation in the hippocampus and long-term depression in the cerebellum.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 3 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human Metabotropic Glutamate Receptor 1 protein images

  • 12.5% SDS-PAGE showing ab114707 at approximately 36.63 kDa stained with Coomassie Blue.

References for Recombinant Human Metabotropic Glutamate Receptor 1 protein (ab114707)

ab114707 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114707.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up