Recombinant Human Metabotropic Glutamate Receptor 8 protein (ab114473)

Overview

  • Product name
    Recombinant Human Metabotropic Glutamate Receptor 8 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCC WHCERCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPII
    • Molecular weight
      36 kDa including tags
    • Amino acids
      486 to 575

Specifications

Our Abpromise guarantee covers the use of ab114473 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ41058
    • GLUR8
    • Glutamate receptor metabotropic 8
    • GPRC1H
    • GRM8
    • GRM8_HUMAN
    • Metabotropic glutamate receptor 8
    • MGC126724
    • mGlu8
    • mGluR8
    see all
  • Function
    Receptor for glutamate. The activity of this receptor is mediated by a G-protein that inhibits adenylate cyclase activity.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 3 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab114473 stained with Coomassie Blue.

References

ab114473 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114473.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up