Recombinant Human Metabotropic Glutamate Receptor 8 protein (ab114473)

Overview

  • Product name
    Recombinant Human Metabotropic Glutamate Receptor 8 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCC WHCERCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPII
    • Molecular weight
      36 kDa including tags
    • Amino acids
      486 to 575

Specifications

Our Abpromise guarantee covers the use of ab114473 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ41058
    • GLUR8
    • Glutamate receptor metabotropic 8
    • GPRC1H
    • GRM8
    • GRM8_HUMAN
    • Metabotropic glutamate receptor 8
    • MGC126724
    • mGlu8
    • mGluR8
    see all
  • Function
    Receptor for glutamate. The activity of this receptor is mediated by a G-protein that inhibits adenylate cyclase activity.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 3 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human Metabotropic Glutamate Receptor 8 protein images

  • 12.5% SDS-PAGE analysis of ab114473 stained with Coomassie Blue.

References for Recombinant Human Metabotropic Glutamate Receptor 8 protein (ab114473)

ab114473 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114473.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up