Recombinant Human Metabotropic Glutamate Receptor 8 protein (ab114473)

Overview

  • Product nameRecombinant Human Metabotropic Glutamate Receptor 8 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO00222
    • SpeciesHuman
    • SequenceKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCC WHCERCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPII
    • Molecular weight36 kDa including tags
    • Amino acids486 to 575

Specifications

Our Abpromise guarantee covers the use of ab114473 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ41058
    • GLUR8
    • Glutamate receptor metabotropic 8
    • GPRC1H
    • GRM8
    • GRM8_HUMAN
    • Metabotropic glutamate receptor 8
    • MGC126724
    • mGlu8
    • mGluR8
    see all
  • FunctionReceptor for glutamate. The activity of this receptor is mediated by a G-protein that inhibits adenylate cyclase activity.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 3 family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human Metabotropic Glutamate Receptor 8 protein images

  • 12.5% SDS-PAGE analysis of ab114473 stained with Coomassie Blue.

References for Recombinant Human Metabotropic Glutamate Receptor 8 protein (ab114473)

ab114473 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114473.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"